PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00045984-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family Nin-like
Protein Properties Length: 537aa    MW: 61032.2 Da    PI: 7.6919
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00045984-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.21.2e-26379428352
            RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ++i l+dl+kyF+ pi++A+++L+v+lTvLKr+CR++GI+RWPhRkiksl
  PSME_00045984-RA 379 ANIALKDLAKYFDVPITEASRSLKVGLTVLKRKCREFGIPRWPHRKIKSL 428
                       79**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.985363448IPR003035RWP-RK domain
PfamPF020424.9E-22380428IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MAGDDVASLN AFPSRPPISF SFWWTKCHHQ QQPHHFLHFM AMESYSPSGS SPSRLQLCAL  60
AVFQNMLNEE LIKSVHLYQL QDGTITAIQR EFMFCPSSYK QISLENIPPV HVCGKENVQE  120
FMANLQEGEE RGLWICIFHY NCNLRPINFT IPNILNLARN PALKTIPELA IDLDSVARFK  180
QALDSSQPQK YLDHEMLNCE VTDMQSNFLS IEGFWPAIPG LTTVHDCIDD ALNRPSNVIE  240
SPLSIDQIDN SFGIRINISN EDNPNPNSRQ LKGCSSCNTN EVRSMTSNNS RCLEKDNQTA  300
DQNSSLSIVD MAVIQSIEHS HAPQNLKNDA SEDPSMLCSK KTNEELHSGA GVKGKKRRAS  360
SEEKDENRQI YRAPTQRVAN IALKDLAKYF DVPITEASRS LKVGLTVLKR KCREFGIPRW  420
PHRKIKSLDS LIQDLQEEAK RQEREDKAAA MAAMKRTRIL ETERQKIEKK PGIDIQKDTK  480
RFRQDIFKRR HKARALKKKY EFSNSNSEDG DPSEEVPSVS TILSLMIDKA RTFPSTN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ0788041e-113FJ078804.2 Pinus taeda isolate 7711 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788051e-113FJ078805.2 Pinus taeda isolate 7721 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788061e-113FJ078806.2 Pinus taeda isolate 7709 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788071e-113FJ078807.2 Pinus taeda isolate 7710 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788081e-113FJ078808.2 Pinus taeda isolate 7718 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788091e-113FJ078809.2 Pinus taeda isolate 7719 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788101e-113FJ078810.2 Pinus taeda isolate 7713 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788111e-113FJ078811.2 Pinus taeda isolate 7716 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788121e-113FJ078812.2 Pinus taeda isolate 7714 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788131e-113FJ078813.2 Pinus taeda isolate 7717 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788141e-113FJ078814.2 Pinus taeda isolate 7715 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788151e-113FJ078815.2 Pinus taeda isolate 7722 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788161e-113FJ078816.2 Pinus taeda isolate 7723 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788181e-113FJ078818.2 Pinus taeda isolate 7724 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788191e-113FJ078819.2 Pinus taeda isolate 7707 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788201e-113FJ078820.2 Pinus taeda isolate 7720 anonymous locus 0_6885_01 genomic sequence.
GenBankFJ0788211e-113FJ078821.2 Pinus taeda isolate 7712 anonymous locus 0_6885_01 genomic sequence.
GenBankJQ2613631e-113JQ261363.1 Pinus radiata isolate 7725 hypothetical protein (0_6885_01) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A068U0G86e-58A0A068U0G8_COFCA; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.12e-37RWP-RK domain-containing protein